Secretogranin V Monoclonal antibody, PBS Only

• 

  IHC staining of human pituitary adenoma using 67406-1-Ig (same clone as 67406-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 67406-1-Ig (Secretogranin V antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67406-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary adenoma using 67406-1-Ig (same clone as 67406-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 67406-1-Ig (Secretogranin V antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67406-1-PBS in a different storage buffer formulation.

Secretogranin V Monoclonal Antibody for IHC, Indirect ELISA

Cat No. 67406-1-PBS

Clone No.1B9H6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IHC, Indirect ELISA

Synonyms

7B2, Neuroendocrine protein 7B2, P7B2, Pituitary polypeptide, SCG5, Secretogranin 5, Secretogranin V, secretogranin V (7B2 protein), SGNE1, SgV

---

Product Information

67406-1-PBS targets Secretogranin V in IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28607

  Product name: Recombinant human SCG5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-212 aa of BC005349

  Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

• Full Name: secretogranin V (7B2 protein)
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC005349
• Gene Symbol: Secretogranin V
• Gene ID (NCBI): 6447
• RRID: AB_2882647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05408
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.