Septin 10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Septin 10 Polyclonal antibody, PBS Only (12420-1-PBS)

• 

  WB analysis of human kidney using 12420-1-AP (same clone as 12420-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12420-1-AP (Septin 10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12420-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12420-1-AP (same clone as 12420-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12420-1-AP (Septin 10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12420-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12420-1-AP (same clone as 12420-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12420-1-AP (Septin 10 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12420-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 12420-1-AP (same clone as 12420-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 12420-1-AP (Septin 10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12420-1-PBS in a different storage buffer formulation.

Septin 10 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12420-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

12420-1-PBS targets Septin 10 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3071

  Product name: Recombinant human SEPT10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC020502

  Sequence: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEA

• Full Name: septin 10
• Calculated Molecular Weight: 53 kDa, 57 kDa
• Observed Molecular Weight: 53-57 kDa
• GenBank Accession Number: BC020502
• Gene Symbol: Septin 10
• Gene ID (NCBI): 151011
• RRID: AB_2186992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0V9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.