CoraLite® Plus 488-conjugated Septin 8 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66188

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 Septin 8 antibody (CL488-66188, Clone: 4A12G9 ) at dilution of 1:200.

• 

  IF Staining of HeLa using CL488-66188

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 Septin 8 antibody (CL488-66188, Clone: 4A12G9 ) at dilution of 1:200.

Septin 8 Monoclonal Antibody for IF/ICC

Cat No. CL488-66188

Clone No.4A12G9

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

IF/ICC

Synonyms

KIAA0202, SEP2, SEPT8, septin 8

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66188 targets Septin 8 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19114

  Product name: Recombinant human SEPT8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-256 aa of BC001329

  Sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDK

• Full Name: septin 8
• Calculated Molecular Weight: 55.6 kDa
• Observed Molecular Weight: 50-58 kDa
• GenBank Accession Number: BC001329
• Gene Symbol: Septin 8
• Gene ID (NCBI): 23176
• RRID: AB_3084219
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: Q92599
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Septin 8, also named as KIAA0202, is a member of the highly conserved septin family. Septins are membrane-associated GTPases which are involved in cytokinesis and cellular morphogenesis. Septin 8 is an interaction partner of Septin 4. It may play a role in platelet secretion.