Use Able AI chat for product recommendations

Siglec-15 Polyclonal antibody

Siglec-15 Polyclonal Antibody for WB, ELISA

Cat No. 28594-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (3)

Applications

WB, ELISA

CD33 antigen like 3, CD33L3, HsT1361, SIGLEC 15, SIGLEC15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, NCI-H1299 cells, PC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28594-1-AP targets Siglec-15 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29829

Product name: Recombinant human SIGLEC15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 20-160 aa of NM_213602

Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGV

Predict reactive species
Full Name sialic acid binding Ig-like lectin 15
Calculated Molecular Weight 36 kDa
Observed Molecular Weight38-40 kDa
GenBank Accession NumberNM_213602
Gene Symbol Siglec-15
Gene ID (NCBI) 284266
RRIDAB_2918178
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6ZMC9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sialic acid binding Ig-like lectin 15 (Siglec-15) is a member of the Siglec family of glycan-recognition proteins. Siglec-15 is a type-I transmembrane protein consisting of two immunoglobulin (Ig)-like domains, a transmembrane domain, and a short cytoplasmic tail (PMID: 17483134). It is mainly expressed on a subset of myeloid lineage cells and can be upregulated in many cancers (PMID: 32939323). Siglec-15 has been reported as a immune suppressor and a potential target for normalization cancer immunotherapy (PMID: 30833750). Siglec-15 has a calculated molecular weight of 36 kDa. It has been detected at 38-40 kDa due to glycosylation (PMID: 32921411).

Protocols

Product Specific Protocols
WB protocol for Siglec-15 antibody 28594-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

J Oral Pathol Med

AARS1 Implicates Malignancy and Immune Infiltration in Head and Neck Squamous Cell Carcinoma, Serving as a Prognostic Predictor

Authors - Shengkai Chen

DNA Cell Biol

Siglec-15 Enhances Cisplatin Resistance in Cervical Cancer Cells by Promoting Mitochondrial Retrograde Signaling Through Activation of the MAPK Pathway.

Authors - Zenghui Li
humanWB

Genes Dis

SIGLEC15 modulates the immunosuppressive microenvironment and suppresses malignant phenotypes in triple-negative breast cancer.

Authors - Zhaofu Tan
  • KD Validated
human,mouse,pigWB

Cell Mol Life Sci

Siglec-15 is a putative receptor for porcine epidemic diarrhea virus infection

Authors - Zhihua Feng

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Rebecca (Verified Customer) (07-21-2022)

Positive staining identified at 1:500 dilution in patient FFPE tissue. Slight background.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Prostate cancer FFPE tissue
Siglec-15 Antibody Immunofluorescence validation (1:500 dilution) in Prostate cancer FFPE tissue (Cat no:28594-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...