CoraLite® Plus 488-conjugated Sortilin Monoclonal antibody

• 

  IF Staining of mouse brain using CL488-68007

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 Sortilin antibody (CL488-68007, Clone: 2B11B9 ) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL488-68007

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 Sortilin antibody (CL488-68007, Clone: 2B11B9 ) at dilution of 1:200.

Sortilin Monoclonal Antibody for IF-P

Cat No. CL488-68007

Clone No.2B11B9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

IF-P

Synonyms

SORT1, 100 kDa NT receptor, Glycoprotein 95, Gp95, Neurotensin receptor 3

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68007 targets Sortilin in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28043

  Product name: Recombinant human SORT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 481-831 aa of BC023542

  Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE

• Full Name: sortilin 1
• Calculated Molecular Weight: 831 aa, 92 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC023542
• Gene Symbol: Sortilin
• Gene ID (NCBI): 6272
• ENSEMBL Gene ID: ENSG00000134243
• RRID: AB_2923857
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99523
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface.