ChromoTek Strep-NanoTrap Agarose, Kit for Immunoprecipitation

The ChromoTek Strep-NanoTrap Agarose Kit consists of an anti-Strep-tag® Nanobody/VHH, which is coupled to agarose beads. It also contains lysis, wash, and elution buffers that can be used for the immunoprecipitation of Strep-tagged proteins from cell extracts of various organisms.
Cat No. qtak

Specificity

Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)

Applications

IP, Co-IP

Type

Nanobody

Conjugate

Agarose

Strep Trap, SAWSHPQFEK-Trap, Strep-tag-Trap

Formats:  Agarose kit
SKU/Size: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

The ChromoTek Strep-NanoTrap Agarose Kit consists of an anti-Strep-tag® Nanobody/VHH, which is coupled to agarose beads. It also contains lysis, wash, and elution buffers that can be used for the immunoprecipitation of Strep-tagged proteins from cell extracts of various organisms.

DescriptionThe Strep-Trap Agarose Kit contains Strep-Trap agarose, lysis, wash, and elution buffers for efficient immunoprecipitation of Strep-tagged proteins.

• Fast, reliable & efficient one-step immunoprecipitation

• Ready-to-use

• No heavy & light antibody chains

• Stable under harsh washing conditions

• Suitable for downstream mass spec analysis

ApplicationsIP, Co-IP
Specificity/TargetBinds specifically to the peptide sequence SAWSHPQFEK, also known as
Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this trap binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as
Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position.
Binding Capacity25 ug of recombinant SAWSHPQFEK-tagged protein (~30 kDa) per 25 uL bead slurry
ConjugateAgarose beads; ~90 um (cross-linked 4% agarose beads)
Elution buffer2x SDS-sample buffer (Lammli)
Wash Buffer Compatibility1M NaCl, 5 mM DTT, 5 mM β-mercaptoethanol, 5 mM TCEP, 2% NP40, 2% Triton X-100, 0.1% SDS, 2-3 M Urea
TypeNanobody
ClassRecombinant
HostAlpaca
Affinity (KD) 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag®
Compatibility with mass spectrometryThe Strep-Trap is optimized for on-bead digestion. For the application note, please click here:
On-bead digest protocol for mass spectrometry
RRIDAB_3107051
Storage Buffer20% ethanol
Storage ConditionShipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. DO not freeze!

Kit components

Component Description
Strep-NanoTrap Agarose20 reactions (500 µl)
Lysis bufferOptimized for cytoplasmic proteins and mammalian cell lysis
RIPA bufferOptimized for nuclear/chromatin proteins and mammalian cell lysis
Wash bufferRemoval of unwanted proteins, peptides, etc.
Dilution bufferDilution of cell lysate
Elution bufferFor acidic elution

||
New chat Able
正在加载,请稍候...