Home
Products
Primary Antibodies
Supervillin Polyclonal antibody, PBS Only (27524-1-PBS)

Filter: AllWBIHC

WB analysis using 27524-1-AP (same clone as 27524-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27524-1-AP (Supervillin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27524-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 27524-1-AP (same clone as 27524-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 27524-1-AP (Supervillin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27524-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 27524-1-AP (same clone as 27524-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27524-1-AP (Supervillin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27524-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 27524-1-AP (same clone as 27524-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27524-1-AP (Supervillin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27524-1-PBS in a different storage buffer formulation.

Supervillin Polyclonal antibody, PBS Only

Name: Supervillin Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27524-1-PBS

Supervillin Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27524-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

SVIL

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

27524-1-PBS targets Supervillin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26196 Product name: Recombinant human Supervillin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1679-1787 aa of NM_003174 Sequence: MFLDWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKF Predict reactive species
Full Name	supervillin
Calculated Molecular Weight	248 kDa
Observed Molecular Weight	205 kDa
GenBank Accession Number	NM_003174
Gene Symbol	SVIL
Gene ID (NCBI)	6840
RRID	AB_3669607
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O95425
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Supervillin (SVIL) belongs to the villin/gelsolin superfamily of actin-binding proteins involved in many cellular processes. A non-muscle-specific form of Supervillin activates androgen receptor activity. Supervillin another isoform, called Archvillin, is expressed in skeletal and cardiac muscle tissue where it plays a role in both muscle fiber structure and signaling. Mutations in Supervillin are associated with myofibrillar Myopathy10 (MFM10), which causes myopathy with myofibrillar disorganization and autophagic vacuoles(PMID: 9867483, 32779703).