Synaptotagmin-11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Synaptotagmin-11 Polyclonal antibody, PBS Only (12031-1-PBS)

• 

  WB analysis using 12031-1-AP (same clone as 12031-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12031-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 12031-1-AP (same clone as 12031-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12031-1-AP (same clone as 12031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12031-1-AP (same clone as 12031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12031-1-PBS in a different storage buffer formulation.

Synaptotagmin-11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12031-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12031-1-PBS targets Synaptotagmin-11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2663

  Product name: Recombinant human SYT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 159-431 aa of BC013690

  Sequence: GSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWHSLSEY

• Full Name: synaptotagmin XI
• Calculated Molecular Weight: 431 aa, 48 kDa
• Observed Molecular Weight: 48 kDa，96 kDa
• GenBank Accession Number: BC013690
• Gene Symbol: Synaptotagmin-11
• Gene ID (NCBI): 23208
• RRID: AB_10638432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BT88
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.