Synaptotagmin-4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Synaptotagmin-4 Polyclonal antibody, PBS Only (12642-1-PBS)

• 

  WB analysis of human brain using 12642-1-AP (same clone as 12642-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12642-1-AP (Synaptotagmin-4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12642-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12642-1-AP (same clone as 12642-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12642-1-AP (Synaptotagmin-4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12642-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12642-1-AP (same clone as 12642-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12642-1-AP (Synaptotagmin-4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12642-1-PBS in a different storage buffer formulation.

Synaptotagmin-4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12642-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

KIAA1342, Synaptotagmin IV, SYT4, SytIV

---

Product Information

12642-1-PBS targets Synaptotagmin-4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3338

  Product name: Recombinant human SYT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 86-425 aa of BC036538

  Sequence: AVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWHVLCDG

• Full Name: synaptotagmin IV
• Calculated Molecular Weight: 425 aa, 48 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC036538
• Gene Symbol: Synaptotagmin-4
• Gene ID (NCBI): 6860
• RRID: AB_2302982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2B2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-4 is an atypical synaptic vesicle protein that is expressed in the dendrites of neurons. It mediates retrograde signals at the synapse and the release of BDNF, and regulates synaptic plasticity, motor learning, and memory. (PMID: 27223326;29166604 )