Filter: AllIHCAffinity

IHC staining of mouse spleen using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of mouse skin using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of mouse skin using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 84069-8-RR (same clone as 84069-8-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 84069-8-RR (Syndecan-1/CD138 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84069-8-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 84069-8-RR
Biolayer interferometry (BLl) kinetic assays of 84069-8-RR against Mouse CD138/Syndecan-1 were performed. The affinity constant is 1.15 nM.

Mouse CD138/Syndecan-1 Recombinant monoclonal antibody, PBS Only

Name: Mouse CD138/Syndecan-1 Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 84069-8-PBS

CD138/Syndecan-1 Uni-rAb^® Recombinant Antibody for IHC, Indirect ELISA

Cat No. 84069-8-PBS

Clone No.241278E8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

CD138, Sdc1, SYND1, Synd-1, Syndecan-1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

84069-8-PBS targets CD138/Syndecan-1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1221 Product name: Recombinant Mouse CD138/Syndecan-1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6HIS Tag: C-6HIS Domain: 23-252 aa of NM_011519.2 Sequence: QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE Predict reactive species
Full Name	syndecan 1
Calculated Molecular Weight	33 kDa
GenBank Accession Number	NM_011519.2
Gene Symbol	Sdc1
Gene ID (NCBI)	20969
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P18828-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CD138, also named as Syndecan-1 (SDC1), is an integral membrane protein. It participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. It is a heparan sulfate proteoglycan expressed on the surface of, and actively shed by, myeloma cells. Altered syndecan-1 expression has been detected in several different tumor types. CD138 was regarded as a useful marker for labeling normal and neoplastic plasma cells and plasmacytoid lymphomas.