Home
Products
Primary Antibodies
TAC1/Substance P Polyclonal antibody, PBS Only (28599-1-PBS)

Filter: AllIHCIF-PIF/ICC

IHC staining of mouse brain using 28599-1-AP (same clone as 28599-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28599-1-AP (TAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 28599-1-AP (same clone as 28599-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28599-1-AP (TAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.
IHC staining of human hypothalamus using 28599-1-AP (same clone as 28599-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hypothalamus tissue slide using 28599-1-AP (TAC1 antibody) at dilution of 1:200 (under 10x lens).. This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.
IHC staining of human hypothalamus using 28599-1-AP (same clone as 28599-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hypothalamus tissue slide using 28599-1-AP (TAC1 antibody) at dilution of 1:200 (under 40x lens).. This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 28599-1-AP (same clone as 28599-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using TAC1 antibody (28599-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 28599-1-AP (same clone as 28599-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using TAC1 antibody (28599-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.
IF Staining of PC-12 using 28599-1-AP (same clone as 28599-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed PC-12 cells using TAC1 antibody (28599-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28599-1-PBS in a different storage buffer formulation.

TAC1/Substance P Polyclonal antibody, PBS Only

Name: TAC1/Substance P Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 28599-1-PBS

TAC1/Substance P Polyclonal Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 28599-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

TAC1, C-terminal-flanking peptide, Protachykinin 1, Protachykinin-1, TAC 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

28599-1-PBS targets TAC1/Substance P in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23477 Product name: Recombinant human TAC1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 20-89 aa of BC018047 Sequence: EEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYG Predict reactive species
Full Name	tachykinin, precursor 1
Calculated Molecular Weight	129 aa, 15 kDa
GenBank Accession Number	BC018047
Gene Symbol	TAC1/Substance P
Gene ID (NCBI)	6863
RRID	AB_2881178
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P20366
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TAC1, also known as Protachykinin-1, is a gene that encodes for a family of neuropeptides known as tachykinins. These peptides are characterized by their ability to rapidly stimulate contraction of intestinal muscle, hence the name "tachykinins". The TAC1 gene and its products are widely distributed in the nervous system, with α-TAC1 mRNA localized in numerous neurons of the brain. β-TAC1 and γ-TAC1 are predominantly expressed in intrinsic enteric neurons and sensory neurons. Additionally, the expression of TAC1, SP, and NKA is observed in various peripheral neurons and non-neural tissues such as the salivary gland, heart, skin, spleen, adrenal gland, and more.