TAC4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAC4 Polyclonal antibody, PBS Only (21232-1-PBS)

• 

  IHC staining of mouse lung using 21232-1-AP (same clone as 21232-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 21232-1-AP (TAC4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21232-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 21232-1-AP (same clone as 21232-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 21232-1-AP (TAC4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21232-1-PBS in a different storage buffer formulation.

TAC4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21232-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

PPT C, HK 1, EKC, EKA/B Endokinin C, EKA Endokinin A/B

---

Product Information

21232-1-PBS targets TAC4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15702

  Product name: Recombinant human TAC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-57 aa of BC111858

  Sequence: MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWEGAGPSIQLQLQEVKTGKASQF

• Full Name: tachykinin 4 (hemokinin)
• Calculated Molecular Weight: 113 aa, 12 kDa
• GenBank Accession Number: BC111858
• Gene Symbol: TAC4
• Gene ID (NCBI): 255061
• RRID: AB_3669363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UU9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAC4, or tachykinin 4, is a gene that encodes for a member of the tachykinin family of peptides, which are known for their rapid stimulation of contraction in intestinal muscles and other physiological functions. The tachykinin family includes three members in mammals: TAC1, TAC3, and TAC4. TAC4, in particular, is involved in a variety of physiological roles and has been implicated in several biological processes.