TAF1A Polyclonal antibody

• 

  WB analysis using 15362-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15362-1-AP (TAF1A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

TAF1A Polyclonal Antibody for WB, ELISA

Cat No. 15362-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RAFI48, RNA polymerase I-specific TBP-associated factor 48 kDa, SL1, TAFI48, TATA box-binding protein-associated factor 1A

---

Tested Applications

• Positive WB detected in: A431 cells, A549 cells, HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15362-1-AP targets TAF1A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8059

  Product name: Recombinant human TAF1A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-450 aa of BC013808

  Sequence: PEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNAVAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLYNFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWKYLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL

• Full Name: TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC013808
• Gene Symbol: TAF1A
• Gene ID (NCBI): 9015
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15573
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAF1A, also named as TAFI48 and SL1, is a component of the transcription factor SL1/TIF-IB complex. TAF1A has two isoform with MW 40 kDa and 48-52 kDa.