TAF3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAF3 Polyclonal antibody, PBS Only (18901-1-PBS)

• 

  WB analysis of cells using 18901-1-AP (same clone as 18901-1-PBS)

  WB results of TAF3 (18901-1-AP) with siRNA sample. (140 kDa band absent in siRNA sample). This data was developed using the same antibody clone with 18901-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18901-1-AP (same clone as 18901-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18901-1-AP (TAF3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18901-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TAF3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18901-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

TAFII-140, TAFII140, TAFII 140, TAF140, TAF(II)140

---

Product Information

18901-1-PBS targets TAF3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13536

  Product name: Recombinant human TAF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 443-721 aa of BC024661

  Sequence: TKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEK

• Full Name: TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
• Calculated Molecular Weight: 929 aa, 104 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC024661
• Gene Symbol: TAF3
• Gene ID (NCBI): 83860
• RRID: AB_2878567
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWG9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAF3, also named as TAF140, is a 140 kDa subunit of Transcription initiation factor TFIID. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF3 has some isoforms with 727aa (~80 kDa), 622aa and 929aa (105 kDa).