Filter: AllWB

WB analysis using 32590-1-AP (same clone as 32590-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 32590-1-AP (TAF7L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32590-1-PBS in a different storage buffer formulation.

TAF7L Polyclonal antibody, PBS Only

Name: TAF7L Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 32590-1-PBS

TAF7L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32590-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Cancer/testis antigen 40, CT40, RNA polymerase II TBP-associated factor subunit Q, TAF2Q, TATA box-binding protein-associated factor 50 kDa

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

32590-1-PBS targets TAF7L in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag38542 Product name: Recombinant human TAF7L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 361-462 aa of NM_024885.3 Sequence: DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK* Predict reactive species
Full Name	TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa
Calculated Molecular Weight	53kDa，462aa
Observed Molecular Weight	53 kDa
GenBank Accession Number	NM_024885.3
Gene Symbol	TAF7L
Gene ID (NCBI)	54457
RRID	AB_3742665
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q5H9L4
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™