TAK1 Polyclonal antibody, PBS Only

• 

  WB analysis using 29167-1-AP (same clone as 29167-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29167-1-AP (TAK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29167-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 29167-1-AP (same clone as 29167-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 29167-1-AP (TAK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29167-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TAK1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29167-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MAP3K7, EC:2.7.11.25, MAP3K 7, mitogen activated protein kinase kinase kinase 7, Mitogen-activated protein kinase kinase kinase 7

---

Product Information

29167-1-PBS targets TAK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30725

  Product name: Recombinant human MAP3K7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 404-579 aa of BC017715

  Sequence: GNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS

• Full Name: mitogen-activated protein kinase kinase kinase 7
• Calculated Molecular Weight: 579 aa, 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC017715
• Gene Symbol: TAK1
• Gene ID (NCBI): 6885
• RRID: AB_2918242
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43318
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAP3K7(Mitogen-activated protein kinase kinase kinase 7) is also named as TAK1 and belongs to the MAP kinase kinase kinase subfamily. It plays an important role in the cascades of cellular responses evoked by changes in the environment. It has been linked to interleukin-1 receptor and tumor necrosis factor receptor signaling (PMID: 16186825). It has 4 isoforms (53-55 kDa, 64-70 kDa and 75-80 kDa) produced by alternative splicing.