TAOK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAOK2 Polyclonal antibody, PBS Only (21188-1-PBS)

• 

  WB analysis of mouse brain using 21188-1-AP (same clone as 21188-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21188-1-AP (TAOK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21188-1-AP (same clone as 21188-1-PBS)

  WB result of TAOK2 antibody (21188-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-control and sh-TAOK2 transfected HEK-293 cells. This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21188-1-AP (same clone as 21188-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21188-1-AP (TAOK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21188-1-AP (same clone as 21188-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21188-1-AP (TAOK2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 21188-1-AP (same clone as 21188-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 21188-1-AP (TAOK2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 21188-1-AP (same clone as 21188-1-PBS)

  IP result of anti-TAOK2 (IP:21188-1-AP, 4ug; Detection:21188-1-AP 1:500) with HEK-293 cells lysate 3000ug. This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 21188-1-AP (same clone as 21188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21188-1-AP (TAOK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 21188-1-AP (same clone as 21188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21188-1-AP (TAOK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21188-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TAOK2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 21188-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

21188-1-PBS targets TAOK2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15521

  Product name: Recombinant human TAOK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 742-969 aa of BC142663

  Sequence: SLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLL

• Full Name: TAO kinase 2
• Calculated Molecular Weight: 1235 aa, 138 kDa
• Observed Molecular Weight: 138-150 kDa
• GenBank Accession Number: BC142663
• Gene Symbol: TAOK2
• Gene ID (NCBI): 9344
• RRID: AB_10755293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAOK2(Serine/threonine-protein kinase TAO2) is also named as KIAA0881, MAP3K17, PSK, PSK1 and belongs to the protein kinase superfamily. TAOK2 is known to modulate gene transcription via its activation of several MAP kinase pathways, including c-Jun amino-terminal kinase (JNK), and has been implicated in the modulation of actin and microtubule dynamics. The time course of TAOK2 expression is consistent with a role for it in neuronal differentiation.(PMID:22735514). The immunogen of this antibody is 742-969 aa of human TAOK2 protein isoform Alpha.This antibody mainly detects the isoform 1/3/4. It can't detect the isoform 2.