TAP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68412-1-Ig (same clone as 68412-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68412-1-Ig (TAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68412-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 68412-1-Ig (same clone as 68412-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68412-1-Ig (TAP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68412-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 68412-1-Ig (same clone as 68412-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68412-1-Ig (TAP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68412-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68412-1-Ig (same clone as 68412-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TAP1 antibody (68412-1-Ig, Clone: 1B8A7 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68412-1-PBS in a different storage buffer formulation.

TAP1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68412-1-PBS

Clone No.1B8A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ABC17, ABCB2, Antigen peptide transporter 1, APT1, D6S114E, FLJ26666, FLJ41500, Peptide supply factor 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF 1, PSF1, RING4, TAP1, TAP1*0102N, TAP1N, Y3

---

Product Information

68412-1-PBS targets TAP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21303

  Product name: Recombinant human TAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 509-808 aa of BC014081

  Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

• Full Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC014081
• Gene Symbol: TAP1
• Gene ID (NCBI): 6890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03518
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70 kDa.