TAP1 Monoclonal antibody

TAP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68412-1-Ig
Clone No.1B8A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

ABC17, ABCB2, Antigen peptide transporter 1, APT1, D6S114E, FLJ26666, FLJ41500, Peptide supply factor 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF 1, PSF1, RING4, TAP1, TAP1*0102N, TAP1N, Y3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA2780 cells, SW 1990 cells, HeLa cels, MDA-MB-231 cells, HaCaT cells, THP-1 cells, Daudi cells, Ramos cells, Raji cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

68412-1-Ig targets TAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21303

Product name: Recombinant human TAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 509-808 aa of BC014081

Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

Predict reactive species
Full Name transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Calculated Molecular Weight 81 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC014081
Gene Symbol TAP1
Gene ID (NCBI) 6890
RRIDAB_3085128
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03518
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70 kDa.

Protocols

Product Specific Protocols
IF protocol for TAP1 antibody 68412-1-IgDownload protocol
IHC protocol for TAP1 antibody 68412-1-IgDownload protocol
WB protocol for TAP1 antibody 68412-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Agric Food Chem

Carnosic Acid: A Novel Selective Inhibitor of ERAP1 by Direct Binding and Its Modulation of Antigen Processing and Presentation

Authors - Jiaqi Wu
Loading...
||
New chat Able
正在加载,请稍候...