TAP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85766-4-RR (same clone as 85766-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85766-4-RR (TAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85766-4-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 85766-4-RR (same clone as 85766-4-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 85766-4-RR (TAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85766-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 85766-4-RR (same clone as 85766-4-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 85766-4-RR (TAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85766-4-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 85766-4-RR (same clone as 85766-4-PBS)

  IP result of anti-TAP1 (IP:85766-4-RR, 4ug; Detection:85766-4-RR 1:1000) with HepG2 cells lysate 1800 ug. This data was developed using the same antibody clone with 85766-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 85766-4-RR (same clone as 85766-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 85766-4-RR (TAP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85766-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85766-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85766-4-RR against Human TAP1 were performed. The affinity constant is below 1 pM.

TAP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 85766-4-PBS

Clone No.250037E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

ABCB2, ATP-binding cassette sub-family B member 2, EC:7.4.2.14, PSF1, PSF-1

---

Product Information

85766-4-PBS targets TAP1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1619

  Product name: Recombinant human TAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 509-808 aa of BC014081

  Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

• Full Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC014081
• Gene Symbol: TAP1
• Gene ID (NCBI): 6890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03518
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells.