TAP1 Recombinant monoclonal antibody, PBS Only

TAP1 Uni-rAb® Recombinant Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 85766-4-PBS
Clone No.250037E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

ABCB2, ATP-binding cassette sub-family B member 2, EC:7.4.2.14, PSF1, PSF-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85766-4-PBS targets TAP1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1619

Product name: Recombinant human TAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 509-808 aa of BC014081

Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

Predict reactive species
Full Name transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Calculated Molecular Weight 81 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC014081
Gene Symbol TAP1
Gene ID (NCBI) 6890
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03518
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells.

Loading...
||
New chat Able
正在加载,请稍候...