TAP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAP2 Polyclonal antibody, PBS Only (10161-1-PBS)

• 

  WB analysis using 10161-1-AP (same clone as 10161-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10161-1-AP (TAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10161-1-AP (same clone as 10161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10161-1-AP (TAP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 10161-1-AP (same clone as 10161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10161-1-AP (TAP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10161-1-PBS in a different storage buffer formulation.

TAP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10161-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

PSF-2, PSF2, EC:7.4.2.14, ATP-binding cassette sub-family B member 3, APT2

---

Product Information

10161-1-PBS targets TAP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0190

  Product name: Recombinant human TAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-223 aa of BC002751

  Sequence: MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINL

• Full Name: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC002751
• Gene Symbol: TAP2
• Gene ID (NCBI): 6891
• RRID: AB_3085365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03519
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAP2, also known as APT2, ABCB3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. TAP2 mediates unidirectional translocation of peptide antigens from cytosol to endoplasmic reticulum (ER) for loading onto MHC class I (MHCI) molecules (PMID: 25656091). Mutations in TAP2 may be associated with Bare lymphocyte syndrome 1 (BLS1) and schizophrenia(PMID: 7517574, 24365204).