TARS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TARS2 Polyclonal antibody, PBS Only (15067-1-PBS)

• 

  WB analysis of HepG2 using 15067-1-AP (same clone as 15067-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15067-1-AP (TARS2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15067-1-AP (same clone as 15067-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15067-1-AP (TARS2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 15067-1-AP (same clone as 15067-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15067-1-AP (TARS2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 15067-1-AP (same clone as 15067-1-PBS)

  IP result of anti-TARS2 (IP:15067-1-AP, 4ug; Detection:15067-1-AP 1:600) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15067-1-AP (same clone as 15067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15067-1-AP (TARS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15067-1-AP (same clone as 15067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15067-1-AP (TARS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15067-1-AP (same clone as 15067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15067-1-AP (TARS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15067-1-AP (same clone as 15067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15067-1-AP (TARS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15067-1-AP (same clone as 15067-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 15067-1-AP (TARS2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15067-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TARS2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15067-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

15067-1-PBS targets TARS2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7074

  Product name: Recombinant human TARS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 369-718 aa of BC000541

  Sequence: EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF

• Full Name: threonyl-tRNA synthetase 2, mitochondrial (putative)
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC000541
• Gene Symbol: TARS2
• Gene ID (NCBI): 80222
• RRID: AB_2200668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BW92
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.