TAT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAT Polyclonal antibody, PBS Only (33698-1-PBS)

• 

  IHC staining of mouse liver using 33698-1-AP (same clone as 33698-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33698-1-AP (TAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33698-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 33698-1-AP (same clone as 33698-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33698-1-AP (TAT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33698-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 33698-1-AP (same clone as 33698-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 33698-1-AP (TAT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33698-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 33698-1-AP (same clone as 33698-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TAT antibody (33698-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 33698-1-PBS in a different storage buffer formulation.

TAT Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 33698-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

EC:2.6.1.5, L-tyrosine:2-oxoglutarate aminotransferase, tyrosine aminotransferase

---

Product Information

33698-1-PBS targets TAT in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39227

  Product name: Recombinant human TAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 294-454 aa of BC130534

  Sequence: IHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK

• Full Name: tyrosine aminotransferase
• GenBank Accession Number: BC130534
• Gene Symbol: TAT
• Gene ID (NCBI): 6898
• RRID: AB_3743054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P17735
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tyrosine aminotransferase, also known as tyrosine transaminase, is the first enzyme in the catabolic pathway of tyrosine. The gene of this transaminase is regulated by glucocorticoid hormones as well as via the cAMP pathway. TAT reversibly catalyses Tyr to 4-hydroxyphenylpyruvate (4-HPP), which is the substrate for pathways producing plastoquinone31, 32, tocopherols33, phenolic acid14, 28, and benzylisoquinoline alkaloid (BIA)34 in plants, although tyrosine is synthesised from 4-HPP by TAT in bacteria (28687763).