TAX1BP1 Polyclonal antibody

• 

  WB analysis using 14424-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14424-1-AP (TAX1BP1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 14424-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14424-1-AP (TAX1BP1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 14424-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TAX1BP1 antibody (14424-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

TAX1BP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14424-1-AP

Publications(25)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TRAF6-binding protein, Tax1-binding protein 1, T6BP, PRO0105

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 20 publications below
• IF: See 6 publications below
• IP: See 2 publications below

Product Information

14424-1-AP targets TAX1BP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5789

  Product name: Recombinant human TAX1BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 454-789 aa of BC050358

  Sequence: KECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD

• Full Name: Tax1 (human T-cell leukemia virus type I) binding protein 1
• Calculated Molecular Weight: 91 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC050358
• Gene Symbol: TAX1BP1
• Gene ID (NCBI): 8887
• RRID: AB_2198921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAX1BP1 (also named as T6BP and TXBP151) inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. It is degraded by caspase-3-like family proteins upon TNF-induced apoptosis. TAX1BP1 may also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. TAX1BP1 binds TRAF6 but not TRAFs 1-5.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell; NF-κB Restricts Inflammasome Activation via Elimination of Damaged Mitochondria.; Authors - Zhenyu Zhong
human	WB	Nat Commun; Activation of lysophagy by a TBK1-SCFFBXO3-TMEM192-TAX1BP1 axis in response to lysosomal damage; Authors - Na Yeon Park
	WB	Mol Cell; PARP5A and RNF146 phase separation restrains RIPK1-dependent necroptosis; Authors - Shouqiao Hou
mouse	WB	Sci Adv; TRAF6 integrates innate immune signals to regulate glucose homeostasis via Parkin-dependent and Parkin-independent mitophagy; Authors - Elena Levi-D'Ancona
mouse	WB	Redox Biol; A detrimental role of NLRP6 in host iron metabolism during Salmonella infection.; Authors - Qifeng Deng
mouse	WB	Autophagy; TNF-induced necroptosis initiates early autophagy events via RIPK3-dependent AMPK activation, but inhibits late autophagy.; Authors - Wenxian Wu