Product Information
34255-1-PBS targets TBC1D10C in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40608 Product name: Recombinant human TBC1D10C protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-138 aa of BC062999 Sequence: SELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRD Predict reactive species |
| Full Name | TBC1 domain family, member 10C |
| Calculated Molecular Weight | 446 aa, 50 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC062999 |
| Gene Symbol | TBC1D10C |
| Gene ID (NCBI) | 374403 |
| RRID | AB_3743181 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8IV04 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TBC1D10C (also known as Carabin or EPI64C) is a negative regulator of dual signaling pathways. It can inhibit the activity of small GTPase Ras through its N-terminal TBC domain, and also suppress the activity of calcineurin through its C-terminal binding site, thereby simultaneously negatively regulating the two key signaling pathways, Ras-MAPK and Ca²⁺-Calcineurin-NFAT.
