TBC1D19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TBC1D19 Polyclonal antibody, PBS Only (21085-1-PBS)

• 

  WB analysis using 21085-1-AP (same clone as 21085-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21085-1-AP (TBC1D19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 21085-1-AP (same clone as 21085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 21085-1-AP (TBC1D19 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 21085-1-AP (same clone as 21085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 21085-1-AP (TBC1D19 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21085-1-PBS in a different storage buffer formulation.

TBC1D19 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21085-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

TBC1 domain family member 19

---

Product Information

21085-1-PBS targets TBC1D19 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15323

  Product name: Recombinant human TBC1D19 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 177-526 aa of BC031642

  Sequence: SFRTHLGLIQVPLKVKDIPELKECFVELGLNIGQLGIDDSTQVPPELFENEHVRIGQKVLAEQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDVLYYEQLKTNVIQHDLLVDSLIYKDVKLTASNDDYYFVFEDYLYQVLLCFSRDTSVLSHFAFNSASPPKSYIRGKLGLEEYAVFYPPNGVIPFHGFSMYVAPLCFLYHEPSKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFETLLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVLAAAVFAFRAVNLMEVTSLAAAEAVLADLFTLKVMPLLQIFLFATVT

• Full Name: TBC1 domain family, member 19
• Calculated Molecular Weight: 526 aa, 60 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC031642
• Gene Symbol: TBC1D19
• Gene ID (NCBI): 55296
• RRID: AB_2878809
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5T2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The function of TBC1D19 remains largely unknown. TBC1D19 may act as a GTPase-activating protein for Rab family protein(s).