TBK1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67211-1-Ig (same clone as 67211-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67211-1-Ig (TBK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67211-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 67211-1-Ig (same clone as 67211-1-PBS)

  U2OS (WT and TBK1 KO) lysates prepared with RIPA buffer, 50 μg protein loaded. 67211-1-Ig incubated at 1:5000 at 4°C overnight in 5% BSA in TBST. Ponceau stained transfers shown on right. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency. This data was developed using the same antibody clone with 67211-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TBK1 Monoclonal Antibody for WB, ELISA

Cat No. 67211-1-PBS

Clone No.2D7B1

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

Serine/threonine-protein kinase TBK1, Serine/threonine protein kinase TBK1, NF-kappa-B-activating kinase, NF kappa B activating kinase, EC:2.7.11.1

---

Product Information

67211-1-PBS targets TBK1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28894

  Product name: Recombinant human TBK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 316-576 aa of BC034950

  Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA

• Full Name: TANK-binding kinase 1
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC034950
• Gene Symbol: TBK1
• Gene ID (NCBI): 29110
• RRID: AB_2882504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHD2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1.