CoraLite® Plus 488-conjugated TBK1 Recombinant monoclonal antibody

TBK1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83686-3
Clone No.240769G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

EC:2.7.11.1, NF kappa B activating kinase, NF-kappa-B-activating kinase, Serine/threonine protein kinase TBK1, Serine/threonine-protein kinase TBK1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83686-3 targets TBK1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28894

Product name: Recombinant human TBK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 316-576 aa of BC034950

Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA

Predict reactive species
Full Name TANK-binding kinase 1
Observed Molecular Weight84 kDa
GenBank Accession NumberBC034950
Gene Symbol TBK1
Gene ID (NCBI) 29110
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UHD2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TBK1 antibody CL488-83686-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...