CoraLite® Plus 488-conjugated TBR1 Monoclonal antibody

TBR1 Monoclonal Antibody for
Cat No. CL488-66564
Clone No.5C3A5

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse, pig

Applications

T box brain protein 1, T box, brain, 1, T brain 1, TBR 1, TBR1, TES 56

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66564 targets TBR1 in applications and shows reactivity with Human, rat, mouse, pig samples.

Tested Reactivity Human, rat, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15262

Product name: Recombinant human TBR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-196 aa of BC104844

Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ

Predict reactive species
Full Name T-box, brain, 1
Calculated Molecular Weight 682 aa, 74 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC104844
Gene Symbol TBR1
Gene ID (NCBI) 10716
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16650
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development. The antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.

Loading...
||
New chat

Able

正在加载,请稍候...