TBX20 Recombinant monoclonal antibody, PBS Only (Capture)

TBX20 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83414-3-PBS
Clone No.240385H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

TBX 20, T-box transcription factor TBX20, T-box protein 20, T box 20, ASD4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83414-3-PBS targets TBX20 as part of a matched antibody pair:

MP00401-1: 83414-3-PBS capture and 83414-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18501

Product name: Recombinant human TBX20 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-119 aa of BC120946

Sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTE

Predict reactive species
Full Name T-box 20
Calculated Molecular Weight 297 aa, 33 kDa
GenBank Accession NumberBC120946
Gene Symbol TBX20
Gene ID (NCBI) 57057
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UMR3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Tbx20 is a transcription factor that is essential for proper heart development in a growing fetus. Any mutations in this gene can result in various forms of congenital heart disease.

Loading...
||
New chat

Able

正在加载,请稍候...