TBX22 Polyclonal antibody

• 

  WB analysis of PC-3 using 11133-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11133-1-AP (TBX22 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11133-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11133-1-AP (TBX22 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11133-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11133-1-AP (TBX22 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

TBX22 Polyclonal Antibody for WB, ELISA

Cat No. 11133-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CLPA, T box 22, T box protein 22, TBOX22, TBX22, TBXX

---

Tested Applications

• Positive WB detected in: PC-3 cells, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11133-1-AP targets TBX22 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1591

  Product name: Recombinant human TBX22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-520 aa of BC014194

  Sequence: QIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPWRPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL

• Full Name: T-box 22
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC014194
• Gene Symbol: TBX22
• Gene ID (NCBI): 50945
• RRID: AB_2200683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y458
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The frontonasal mass gives rise to the facial midline and fuses with the maxillary prominence to form the upper lip. T-box transcription factor 22 (Tbx22) belongs to the T-box family of transcription factors, which is essential for normal craniofacial development[PMID: 20033915]. Mutation in TBX22 in the frontnasal mass is reported in families with X-linked cleft palate and ankyloglossia [PMID:19816249].