Mouse TCB1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse thymus using 84878-5-RR (same clone as 84878-5-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 84878-5-RR (TCB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 84878-5-RR (same clone as 84878-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84878-5-RR (TCB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84878-5-RR (same clone as 84878-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84878-5-RR (same clone as 84878-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse thymus using 84878-5-RR (same clone as 84878-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse thymus using 84878-5-RR (same clone as 84878-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse thymus using 84878-5-RR (same clone as 84878-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse thymus tissue using TCB1 antibody (84878-5-RR, Clone: 241802B12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84878-5-PBS in a different storage buffer formulation.

TCB1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84878-5-PBS

Clone No.241802B12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

241802B12

---

Product Information

84878-5-PBS targets TCB1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2437

  Product name: Recombinant Mouse TCB1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-140 aa of

  Sequence: EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS

• Full Name: TCB1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 38 kDa
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01852
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.