TCB1 Recombinant monoclonal antibody

• 

  WB analysis of mouse thymus using 84878-5-RR

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 84878-5-RR (TCB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84878-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84878-5-RR (TCB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 84878-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 84878-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 84878-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 84878-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 84878-5-RR (TCB1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse thymus using 84878-5-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse thymus tissue using TCB1 antibody (84878-5-RR, Clone: 241802B12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TCB1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 84878-5-RR

Clone No.241802B12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

241802B12

---

Tested Applications

• Positive WB detected in: EL-4 cells, mouse thymus tissue, mouse brain tissue, mouse spleen tissue
• Positive IHC detected in: mouse spleen tissue, mouse thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84878-5-RR targets TCB1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2437

  Product name: Recombinant Mouse TCB1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-140 aa of

  Sequence: EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS

• Full Name: TCB1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 38 kDa
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01852
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.