TCF20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TCF20 Polyclonal antibody, PBS Only (32030-1-PBS)

• 

  WB analysis using 32030-1-AP (same clone as 32030-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32030-1-AP (TCF20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32030-1-PBS in a different storage buffer formulation.

TCF20 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32030-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

KIAA0292, Nuclear factor SPBP, Protein AR1, SPBP, SPRE-binding protein

---

Product Information

32030-1-PBS targets TCF20 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36912

  Product name: Recombinant human TCF20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 480-650 aa of NM_005650

  Sequence: TPQKKTSKRPSSSKKADSCTNSEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRLNASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVSREAMTGRVEKPGGQDKGSQEDDPAATQRPPSNGGAKETSHA

• Full Name: transcription factor 20 (AR1)
• Calculated Molecular Weight: 1960aa, 212 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_005650
• Gene Symbol: TCF20
• Gene ID (NCBI): 6942
• RRID: AB_3670174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UGU0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transcription Factor 20 (TCF20) is a transcriptional activator that binds to the regulatory region of MMP3 and thereby controls stromelysin expression. It stimulates the activity of various transcriptional activators such as JUN, SP1, PAX6 and ETS1, suggesting a function as a coactivator (PMID: 10995766). The calculated molecular weight of TCF20 is 211 kDa, but due to extensive modifications (Glycosylation, Sumoylation. Phosphorylation), the observed molecular weight is about 250 kda.