TCF4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68607-1-Ig (same clone as 68607-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68607-1-Ig (TCF4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68607-1-PBS in a different storage buffer formulation.

TCF4 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68607-1-PBS

Clone No.1C9A1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

1C9A1, bHLHb19, Class B basic helix-loop-helix protein 19, E2 2, ITF 2

---

Product Information

68607-1-PBS targets TCF4 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17897

  Product name: Recombinant human TCF4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 407-560 aa of BC125084

  Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE

• Full Name: transcription factor 4
• Calculated Molecular Weight: 671 aa, 72 kDa
• Observed Molecular Weight: 72 kDa; 68 kDa
• GenBank Accession Number: BC125084
• Gene Symbol: TCF4
• Gene ID (NCBI): 6925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15884
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.