TCF1/TCF7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84089-4-RR (same clone as 84089-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84089-4-RR (TCF7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84089-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84089-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84089-4-RR against Human TCF1/TCF7 were performed. The affinity constant is below 1 pM.

TCF1/TCF7 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84089-4-PBS

Clone No.241154D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

TCF7, 241154D2, T cell factor 1, TCF 1, TCF 7

---

Product Information

84089-4-PBS targets TCF1/TCF7 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5792

  Product name: Recombinant human TCF7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-384 aa of BC048769

  Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL

• Full Name: transcription factor 7 (T-cell specific, HMG-box)
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC048769
• Gene Symbol: TCF1/TCF7
• Gene ID (NCBI): 6932
• ENSEMBL Gene ID: ENSG00000081059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P36402
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCF7, also known as TCF1, belongs to the TCF/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317).