TCF1/TCF7 Recombinant monoclonal antibody, PBS Only

TCF1/TCF7 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84089-4-PBS
Clone No.241154D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

TCF7, 241154D2, T cell factor 1, TCF 1, TCF 7

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84089-4-PBS targets TCF1/TCF7 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5792

Product name: Recombinant human TCF7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-384 aa of BC048769

Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL

Predict reactive species
Full Name transcription factor 7 (T-cell specific, HMG-box)
Calculated Molecular Weight 42 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC048769
Gene Symbol TCF1/TCF7
Gene ID (NCBI) 6932
ENSEMBL Gene IDENSG00000081059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP36402
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TCF7, also known as TCF1, belongs to the TCF/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317).

Loading...
||
New chat Able
正在加载,请稍候...