Use Able AI chat for product recommendations

TCF7L1 Recombinant monoclonal antibody, PBS Only (Capture)

TCF7L1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83588-3-PBS
Clone No.240544F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

240544F1, TCF3, TCF-3, TCF4, TCF7L2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83588-3-PBS targets TCF7L1 as part of a matched antibody pair:

MP00573-1: 83588-3-PBS capture and 83588-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34253

Product name: Recombinant human TCF7L1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 238-587 aa of BC058894

Sequence: GAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSRQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH

Predict reactive species
Full Name transcription factor 7-like 1 (T-cell specific, HMG-box)
Calculated Molecular Weight 63 kDa
GenBank Accession NumberBC058894
Gene Symbol TCF7L1
Gene ID (NCBI) 83439
RRIDAB_3671202
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9HCS4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TCF7L1 is one of TCF/LEF transcription factors that are mediators of the Wnt signaling pathway and are antagonized by the TGF-beta signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It's necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis

Loading...
||
New chat

Able

正在加载,请稍候...