TCF7L1 Recombinant monoclonal antibody

TCF7L1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83588-3-RR
Clone No.240544F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Transcription factor 7-like 1, TCF7L2, TCF4, TCF-3, TCF3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HeLa cells, HEK-293 cells, NCCIT cells, NIH/3T3 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83588-3-RR targets TCF7L1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34253

Product name: Recombinant human TCF7L1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 238-587 aa of BC058894

Sequence: GAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSRQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH

Predict reactive species
Full Name transcription factor 7-like 1 (T-cell specific, HMG-box)
Calculated Molecular Weight 63 kDa
Observed Molecular Weight63 kDa, 75 kDa
GenBank Accession NumberBC058894
Gene Symbol TCF7L1
Gene ID (NCBI) 83439
RRIDAB_3671202
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9HCS4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCF7L1 is one of TCF/LEF transcription factors that are mediators of the Wnt signaling pathway and are antagonized by the TGF-beta signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It's necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis

Protocols

Product Specific Protocols
FC protocol for TCF7L1 antibody 83588-3-RRDownload protocol
WB protocol for TCF7L1 antibody 83588-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...