TCIRG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TCIRG1 Polyclonal antibody, PBS Only (12649-1-PBS)

• 

  WB analysis using 12649-1-AP (same clone as 12649-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12649-1-AP (TCIRG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12649-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 12649-1-AP (same clone as 12649-1-PBS)

  WB result of TCIRG1 antibody (12649-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TCIRG1 transfected A431 cells. This data was developed using the same antibody clone with 12649-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 12649-1-AP (same clone as 12649-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 12649-1-AP (TCIRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12649-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 12649-1-AP (same clone as 12649-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 12649-1-AP (TCIRG1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12649-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 12649-1-AP (same clone as 12649-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using TCIRG1 antibody 12649-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 12649-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TCIRG1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12649-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

T-cell immune regulator 1, OPTB1, OC-116 kDa, OC116, ATP6V0A3

---

Product Information

12649-1-PBS targets TCIRG1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3378

  Product name: Recombinant human TCIRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-395 aa of BC018133

  Sequence: CVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPTLIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIIT

• Full Name: T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
• Calculated Molecular Weight: 830 aa, 93 kDa
• Observed Molecular Weight: 92 kDa, 65-70 kDa
• GenBank Accession Number: BC018133
• Gene Symbol: TCIRG1
• Gene ID (NCBI): 10312
• RRID: AB_10644329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13488
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCIRG1, also known as V ATPase 116 kDa isoform a3, TIRC7, OPTB1, belongs to the V-ATPase 116 kDa subunit family, TCIRG1 seems to be directly involved in T-cell activation (PubMed:10329006). Alternative splicing results in multiple transcript variants. Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus (PMID: 15809087, 24753205). Mutations in TCIRG1 are associated with Osteopetrosis, autosomal recessive 1 (OPTB1)( PMID: 11532986).