Product Information
15221-1-PBS targets TCTA in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7425 Product name: Recombinant human TCTA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC005157 Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE Predict reactive species |
| Full Name | T-cell leukemia translocation altered gene |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC005157 |
| Gene Symbol | TCTA |
| Gene ID (NCBI) | 6988 |
| RRID | AB_3085453 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P57738 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TCTA is required for cellular fusion during osteoclastogenesis. TCTA mRNA is expressed ubiquitously in normal tissues, with the highest levels of expression seen in the kidney.

