TCTA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TCTA Polyclonal antibody, PBS Only (15221-1-PBS)

• 

  WB analysis using 15221-1-AP (same clone as 15221-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15221-1-AP (TCTA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15221-1-PBS in a different storage buffer formulation.

TCTA Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15221-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15221-1-PBS targets TCTA in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7425

  Product name: Recombinant human TCTA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC005157

  Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE

• Full Name: T-cell leukemia translocation altered gene
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC005157
• Gene Symbol: TCTA
• Gene ID (NCBI): 6988
• RRID: AB_3085453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57738
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCTA is required for cellular fusion during osteoclastogenesis. TCTA mRNA is expressed ubiquitously in normal tissues, with the highest levels of expression seen in the kidney.