• Featured Product
  • KD/KO Validated

HRP-conjugated TDP-43 (human specific) Monoclonal antibody

TDP-43 (human specific) Monoclonal Antibody for WB
Cat No. HRP-60019
Clone No.6H6E12

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB

TARDBP, TDP 43, TDP43, TDP-43, TAR DNA-binding protein 43

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  HRP
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, HepG2 cells, Jurkat cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

HRP-60019 targets TDP-43 (human specific) in WB applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1231

Product name: Recombinant human TDP-43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-260 aa of BC001487

Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA

Predict reactive species
Full Name TAR DNA binding protein
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC001487
Gene Symbol TDP-43
Gene ID (NCBI) 23435
RRIDAB_3673980
Conjugate HRP
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13148
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Transactivation response (TAR) DNA-binding protein of 43 kDa (also known as TARDBP or TDP-43) was first isolated as a transcriptional inactivator binding to the TAR DNA element of the HIV-1 virus. Neumann et al. (2006) found that a hyperphosphorylated, ubiquitinated, and cleaved form of TARDBP, known as pathologic TDP-43, is the major component of the tau-negative and ubiquitin-positive inclusions that characterize amyotrophic lateral sclerosis (ALS) and the most common pathological subtype of frontotemporal lobar degeneration (FTLD-U). Various forms of TDP-43 exist, including 18-35 kDa of cleaved C-terminal fragments, 45-50 kDa phospho-protein, 55 kDa glycosylated form, 75 kDa hyperphosphorylated form, and 90-300 kDa cross-linked form. (PMID: 17023659,19823856, 21666678, 22193176). 60019-2-Ig is a mouse monoclonal antibody recognizing the cleavage product of 20-30 kDa in addition to the native and phosphorylated forms of TDP-43. Immunohistochemical analyses of TDP-43 using this antibody detect both normal diffuse nuclear staining and insoluble inclusions in pathologic tissues. Notably this antibody only recognizes human TDP-43 but not reacts with mouse or rat TDP-43.

Protocols

Product Specific Protocols
WB protocol for HRP TDP-43 (human specific) antibody HRP-60019Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...