TEAD3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TEAD3 Polyclonal antibody, PBS Only (13120-1-PBS)

• 

  WB analysis using 13120-1-AP (same clone as 13120-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13120-1-AP (TEAD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13120-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13120-1-AP (same clone as 13120-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13120-1-AP (TEAD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13120-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 13120-1-AP (same clone as 13120-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 13120-1-AP (TEAD3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13120-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse intestine using 13120-1-AP (same clone as 13120-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 13120-1-AP (TEAD3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13120-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 13120-1-AP (same clone as 13120-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 13120-1-AP (TEAD3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13120-1-PBS in a different storage buffer formulation.

TEAD3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13120-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DTEF 1, DTEF-1, ETFR 1, TEA domain family member 3, TEAD 3

---

Product Information

13120-1-PBS targets TEAD3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3875

  Product name: Recombinant human TEAD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC027877

  Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

• Full Name: TEA domain family member 3
• Calculated Molecular Weight: 435 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC027877
• Gene Symbol: TEAD3
• Gene ID (NCBI): 7005
• RRID: AB_2203068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99594
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TEAD3, others named ranscriptional enhancer factor 5(TEF5), a member of family of transcription factors that plays a key role in the Hippo signaling pathway, suggesting involve in organ and tumor suppression by restricting proliferation and promoting. TEAD3 contains the TEA/ATTS DNA-binding domain. Human TEAD3 has a strong mRNA expression in placenta and choriocarcinoma cells(JEG-3), but low in Hela, HepG2 and MCF-7. This is a rabbit polyclonal anti-TEAD3 antibody raised against part of C-terminal chain of human TEAD3.