TEKT5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TEKT5 Polyclonal antibody, PBS Only (26108-1-PBS)

• 

  WB analysis using 26108-1-AP (same clone as 26108-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26108-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 26108-1-AP (same clone as 26108-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26108-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 26108-1-AP (same clone as 26108-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26108-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 26108-1-AP (same clone as 26108-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26108-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 26108-1-AP (same clone as 26108-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 26108-1-AP (TEKT5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26108-1-PBS in a different storage buffer formulation.

TEKT5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26108-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26108-1-PBS targets TEKT5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23295

  Product name: Recombinant human TEKT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-146 aa of BC130336

  Sequence: MEFLGTTQTASYCGPKKCCGLTSLPAVQAPVIQECYQPYYLPGYRYLNSWRPSLFYKIANVQTCPDESTSTLRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLS

• Full Name: tektin 5
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC130336
• Gene Symbol: TEKT5
• Gene ID (NCBI): 146279
• RRID: AB_2880381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96M29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.