CoraLite®594-conjugated TELO2 Monoclonal antibody

TELO2 Monoclonal Antibody for IF/ICC

Cat No. CL594-66077
Clone No.3H10F4

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF/ICC

CLK2, DKFZp434A073, FLJ10924, hCLK2, KIAA0683, Protein clk 2 homolog, TEL2, TELO2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66077 targets TELO2 in IF/ICC applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8834

Product name: Recombinant human TELO2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 488-837 aa of BC017188

Sequence: DLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATREVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALNYSLRQRMDILDVLTLAAQELSRPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASDWRVVVEERIRSKTQRLSKGGPRQGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGEDQLVLGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP

Predict reactive species
Full Name TEL2, telomere maintenance 2, homolog (S. cerevisiae)
Calculated Molecular Weight 837 aa, 92 kDa
Observed Molecular Weight 92 kDa
GenBank Accession NumberBC017188
Gene Symbol TELO2
Gene ID (NCBI) 9894
RRIDAB_2883503
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y4R8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TELO2 gene encodes a telomere length regulation protein TEL2 homolog. TELO2 may be involved in telomere length regulation and can form TTT complex with TTI1 and TTI2. TTT complex is required to stabilize protein levels of PIKK family proteins and is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and MMC. The activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals, can be promoted, stabilized and maintained by TELO2.

Protocols

Product Specific Protocols
IF protocol for CL594 TELO2 antibody CL594-66077Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...