TESC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TESC Polyclonal antibody, PBS Only (11125-1-PBS)

• 

  WB analysis using 11125-1-AP (same clone as 11125-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11125-1-AP (TESC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11125-1-AP (same clone as 11125-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11125-1-AP (TESC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 11125-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 11125-1-AP (TESC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11125-1-AP (same clone as 11125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11125-1-AP (same clone as 11125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11125-1-AP (same clone as 11125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11125-1-AP (same clone as 11125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11125-1-AP (same clone as 11125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11125-1-AP (TESC antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 11125-1-AP (same clone as 11125-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TESC antibody (11125-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 11125-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TESC Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11125-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TSC, Tescalcin, CHP3

---

Product Information

11125-1-PBS targets TESC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1596

  Product name: Recombinant human TESC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC015221

  Sequence: MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH

• Full Name: tescalcin
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC015221
• Gene Symbol: TESC
• Gene ID (NCBI): 54997
• RRID: AB_2201727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BS2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.