TFAP2A/AP-2 Monoclonal antibody

TFAP2A/AP-2 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67076-1-Ig
Clone No.1B12F11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

TFAP2A, TFAP2A,AP-2, 1B12F11, Activating enhancer-binding protein 2-alpha, AP 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, HeLa cells, HSC-T6 cells, MCF-7 cells, HepG2 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 3 publications below

Product Information

67076-1-Ig targets TFAP2A/AP-2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4112

Product name: Recombinant human TFAP2A,AP-2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 79-431 aa of BC017754

Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Predict reactive species
Full Name transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Calculated Molecular Weight 431 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC017754
Gene Symbol TFAP2A/AP-2
Gene ID (NCBI) 7020
RRIDAB_2882384
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05549
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The activator protein-2 (AP-2) family of transcription factors comprises five 52-kDa isoforms (AP-2α, AP-2β, AP-2γ, AP-2δ, and AP-2ε), which share a common structure: a proline/glutamine-rich transactivation domain in the N-terminal region and a helix-span-helix domain in the C-terminal region, which mediates dimerization and site-specific DNA binding. Depending on the cellular context, the AP-2 transcription factors are individually associated either with cell differentiation and development or with cancer progression/regression. [PMID:21966377] TFAP2A (AP-2-alpha) is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation [PMID:11694877]

Protocols

Product Specific Protocols
FC protocol for TFAP2A/AP-2 antibody 67076-1-IgDownload protocol
IHC protocol for TFAP2A/AP-2 antibody 67076-1-IgDownload protocol
WB protocol for TFAP2A/AP-2 antibody 67076-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancer Cell Int

HNRNPC promotes progression of non-small cell lung cancer by maintaining TFAP2A mRNA stability

Authors - Minghua Liao
humanIHC

Front Genet

Identifification and validation of ferroptosis signatures and immune infifiltration characteristics associated with intervertebral disc degeneration

Authors - Feng Zhang
humanIHC

Oncol Rep

TFAP2A promotes cervical cancer via a positive feedback pathway with PD‑L1

Authors - Junyuan Yang
Loading...
||
New chat Able
正在加载,请稍候...