TFAP2A/AP-2 Monoclonal antibody, PBS Only

TFAP2A/AP-2 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67076-1-PBS
Clone No.1B12F11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

TFAP2A, TFAP2A,AP-2, 1B12F11, Activating enhancer-binding protein 2-alpha, AP 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67076-1-PBS targets TFAP2A/AP-2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4112

Product name: Recombinant human TFAP2A,AP-2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 79-431 aa of BC017754

Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Predict reactive species
Full Name transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Calculated Molecular Weight 431 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC017754
Gene Symbol TFAP2A/AP-2
Gene ID (NCBI) 7020
RRIDAB_2882384
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05549
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The activator protein-2 (AP-2) family of transcription factors comprises five 52-kDa isoforms (AP-2α, AP-2β, AP-2γ, AP-2δ, and AP-2ε), which share a common structure: a proline/glutamine-rich transactivation domain in the N-terminal region and a helix-span-helix domain in the C-terminal region, which mediates dimerization and site-specific DNA binding. Depending on the cellular context, the AP-2 transcription factors are individually associated either with cell differentiation and development or with cancer progression/regression. [PMID:21966377] TFAP2A (AP-2-alpha) is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation [PMID:11694877]

Loading...
||
New chat Able
正在加载,请稍候...