TFAP2E Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TFAP2E Polyclonal antibody, PBS Only (25829-1-PBS)

• 

  WB analysis of A375 using 25829-1-AP (same clone as 25829-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 25829-1-AP (same clone as 25829-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 25829-1-AP (same clone as 25829-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 25829-1-AP (same clone as 25829-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 25829-1-AP (same clone as 25829-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 25829-1-AP (TFAP2E antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 25829-1-AP (same clone as 25829-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 25829-1-AP (TFAP2E antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 25829-1-AP (same clone as 25829-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using 25829-1-AP (TFAP2E antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25829-1-PBS in a different storage buffer formulation.

TFAP2E Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25829-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25829-1-PBS targets TFAP2E in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23023

  Product name: Recombinant human TFAP2E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 58-219 aa of BC041175

  Sequence: YGQAPDAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPPARALGLDPRRDYATAVPRLLHGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSL

• Full Name: transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
• Calculated Molecular Weight: 442 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC041175
• Gene Symbol: TFAP2E
• Gene ID (NCBI): 339488
• RRID: AB_2880258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6VUC0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.