Use Able AI chat for product recommendations

TFF2 Polyclonal antibody

TFF2 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 13681-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IP, ELISA, Blocking assay

SML1, SP, Spasmolysin, Spasmolytic polypeptide, trefoil factor 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman stomach tissue, human urine sample
Positive IP detected inmouse stomach tissue
Positive IHC detected inhuman stomach tissue, human stomach cancer tissue, mouse stomach tissue, mouse small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse stomach tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13681-1-AP targets TFF2 in WB, IHC, IF-P, IP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, hamster, gerbil
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4537

Product name: Recombinant human TFF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-129 aa of BC032820

Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Predict reactive species
Full Name trefoil factor 2
Calculated Molecular Weight 129 aa, 14 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC032820
Gene Symbol TFF2
Gene ID (NCBI) 7032
RRIDAB_10598321
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ03403
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).

Protocols

Product Specific Protocols
IF protocol for TFF2 antibody 13681-1-APDownload protocol
IHC protocol for TFF2 antibody 13681-1-APDownload protocol
IP protocol for TFF2 antibody 13681-1-APDownload protocol
WB protocol for TFF2 antibody 13681-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Nature

A revised airway epithelial hierarchy includes CFTR-expressing ionocytes.

Authors - Daniel T Montoro
mouseIF

Nat Genet

Systematic identification of cell-fate regulatory programs using a single-cell atlas of mouse development.

Authors - Lijiang Fei
mouse,humanIHC,IF

Nat Cell Biol

A tumour-resident Lgr5+ stem-cell-like pool drives the establishment and progression of advanced gastric cancers.

Authors - A Fatehullah
mouseIHC,IF

Nat Cell Biol

Lgr5-expressing chief cells drive epithelial regeneration and cancer in the oxyntic stomach.

Authors - Marc Leushacke
humanIF

Gut

Dissecting transcriptional heterogeneity in primary gastric adenocarcinoma by single cell RNA sequencing.

Authors - Min Zhang
mouseIF

Gastroenterology

Induction of gastric cancer by successive oncogenic activation in the corpus.

Authors - Daisuke Douchi

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hongxue (Verified Customer) (05-13-2022)

WB works.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse liver
Loading...
||
New chat

Able

正在加载,请稍候...