Tested Applications
| Positive WB detected in | human stomach tissue, human urine sample |
| Positive IP detected in | mouse stomach tissue |
| Positive IHC detected in | human stomach tissue, human stomach cancer tissue, mouse stomach tissue, mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse stomach tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13681-1-AP targets TFF2 in WB, IHC, IF-P, IP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, hamster, gerbil |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4537 Product name: Recombinant human TFF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species |
| Full Name | trefoil factor 2 |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| Observed Molecular Weight | 18-20 kDa |
| GenBank Accession Number | BC032820 |
| Gene Symbol | TFF2 |
| Gene ID (NCBI) | 7032 |
| RRID | AB_10598321 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03403 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TFF2 antibody 13681-1-AP | Download protocol |
| IHC protocol for TFF2 antibody 13681-1-AP | Download protocol |
| IP protocol for TFF2 antibody 13681-1-AP | Download protocol |
| WB protocol for TFF2 antibody 13681-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-TFF2 antibody (catalog no. 13681-1-AP) has 58 citations. These appear in high-impact journals including Nature, Science, Cancer Cell, Nature Genetics, Nature Cell Biology, Nature Communications, Gastroenterology, Cell Reports, Gut, and Cell Death & Disease, among others. The research fields span gastric and pancreatic cancer, spasmolytic polypeptide-expressing metaplasia (SPEM), epithelial regeneration and stem cells, Helicobacter pylori infection, inflammation, and organoid studies, with applications mainly in IHC, IF, and WB.
| Species | Application | Title |
|---|---|---|
Cancer Cell A conserved re-epithelialization program underlies malignancy in pancreatic ductal adenocarcinoma. | ||
Gastroenterology Induction of gastric cancer by successive oncogenic activation in the corpus. | ||
Nat Genet Systematic identification of cell-fate regulatory programs using a single-cell atlas of mouse development. | ||
Gut Dissecting transcriptional heterogeneity in primary gastric adenocarcinoma by single cell RNA sequencing. |
Reviews
What customers say
The single available review reports using this antibody at a 1:1000 dilution for Western Blot on mouse liver tissue, with a brief comment confirming "WB works." The reviewer rated the product 3 out of 5. Overall, the feedback is minimal but positive regarding its performance in Western Blot applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hongxue (Verified Customer) (05-13-2022) | WB works.
|
