CoraLite® Plus 488-conjugated TFF2 Polyclonal antibody

TFF2 Polyclonal Antibody for IF-P
Cat No. CL488-13681

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

SML1, SP, Spasmolysin, Spasmolytic polypeptide, TFF2, trefoil factor 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse stomach tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13681 targets TFF2 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4537

Product name: Recombinant human TFF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-129 aa of BC032820

Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Predict reactive species
Full Name trefoil factor 2
Calculated Molecular Weight 129 aa, 14 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC032820
Gene Symbol TFF2
Gene ID (NCBI) 7032
RRIDAB_3083945
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ03403
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TFF2 antibody CL488-13681Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...